PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG026100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 334aa    MW: 35227.4 Da    PI: 9.8133
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG026100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.8e-19158212256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++k+q  +Le++F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Pavir.4KG026100.1.p 158 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTK 212
                          678899***********************************************98 PP

2HD-ZIP_I/II124.83.9e-40158248192
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlsk+q+++LE++F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLeke ++Lr +
  Pavir.4KG026100.1.p 158 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLEKELADLR-A 246
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 lk 92 
                          lk
  Pavir.4KG026100.1.p 247 LK 248
                          55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-18139212IPR009057Homeodomain-like
PROSITE profilePS5007116.439154214IPR001356Homeobox domain
SMARTSM003891.1E-16156218IPR001356Homeobox domain
SuperFamilySSF466895.43E-18156223IPR009057Homeodomain-like
CDDcd000861.33E-14158215No hitNo description
PfamPF000462.0E-16158212IPR001356Homeobox domain
PRINTSPR000315.0E-5185194IPR000047Helix-turn-helix motif
PROSITE patternPS000270189212IPR017970Homeobox, conserved site
PRINTSPR000315.0E-5194210IPR000047Helix-turn-helix motif
PfamPF021831.6E-9214248IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.2E-21214257IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MPLPSTPPTR HPSSPTPAGT YTHLARTSSS YQRMMMPQSG GSLDLGLSLG LTSQGSLSSS  60
TTSGALSPWA AALSSVDGDA MTRRDAHAQQ QQQHGAAAAA MDPDRAAMRA STSPDSAAAL  120
SSGASGDNNK RERGELERTG SGGVRSDEED GADGAGGRKK LRLSKDQAAV LEDCFKTHST  180
LNPKQKVALA NRLGLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRWCERL ADENKRLEKE  240
LADLRALKAA PSPAAQPASP AATLTMCPSC RRVAAAAGAP AANHHQQCHP KSNAAAAGNV  300
VPSHCQFFPA AVDRTGQSTW NAAAAPLVTR ELF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1206214RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.147240.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932881e-149FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964497.11e-136PREDICTED: homeobox-leucine zipper protein HOX2-like
SwissprotQ5VPE32e-94HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U862e-94HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLK3XYL11e-136K3XYL1_SETIT; Uncharacterized protein
STRINGSi007019m1e-136(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.18e-51homeobox from Arabidopsis thaliana